JobDrop

Rice University jobs

Browse current Rice University openings that JobDrop found directly from the company's careers source.

Vice President, Chief Financial Officer & Treasurer

Rice University · Houston, TX, US · Posted 2026-09-01

### Summary The Vice President, Chief Financial Officer & Treasurer leads the Office of Budget and Finance. Guided by the University's vision for the future, the office upholds the financial integrity, transparency, and strategic allocation of resources. Through responsible stewardship of funds, the office supports aca

VicePresidentChiefFinancialOfficerTreasurerofficesummary

Clinic Administrative Assistant

Rice University · Houston, TX, US · Posted 2026-08-30

### Summary The Clinic Administrative Assistant provides essential administrative and operational support to Student Health Services at Rice University. Serving as the primary front-desk contact, this position will welcome students seeking care, handle clinic communications, and maintain accurate records in our electro

ClinicAdministrativeAssistanthealthsummaryprovidesessentialoperational

Groundskeeper

Rice University · Houston, TX, US · Posted 2026-08-28

### Summary The Groundskeeper will perform general landscape maintenance, including mowing, edging, trimming, pruning, raking, planting, watering, weeding, caring for trees and shrubs, performing minor irrigation repairs, and assisting with pest control on campus. The Groundskeeper will also clean streets, sidewalks, l

Groundskeeperperformsummarygenerallandscapemaintenancemowingedging

Experiential Learning Coordinator

Rice University · Houston, TX, US · Posted 2026-08-28

### Summary Launch the next generation of sport industry leaders. As the Experiential Learning Coordinator, you will bridge classroom learning with high-impact career opportunities, cultivating key industry partnerships, guiding students through internship placements, and elevating career readiness across the Departmen

ExperientialLearningCoordinatorsportindustrycareerstudentssummary

Research Specialist – BMED

Rice University · Houston, TX, US · Posted 2026-08-28

### Summary The Research Specialist will be responsible for assisting in conducting guided research in the Biobehavioral Mechanisms Explaining Disparities (BMED) Lab. Under the guidance of the lab manager and/or project coordinator, the individual will assist with conducting participant visits and maintaining study mat

ResearchSpecialistBMEDindividualconductingparticipantstudyinformation

Postdoctoral Associate - BioSciences

Rice University · Houston, TX, US · Posted 2026-08-27

### Summary The Hennelly Lab is hiring a Postdoctoral Research Associate in evolutionary and population genomics in mammalian systems. The project will involve analyzing genomic data from modern and historical/ancient genomic datasets, and using computational methods to assess patterns and evolutionary consequences of

PostdoctoralBioSciencesevolutionarygenomicsummaryhennellyhiringresearch

House Manager (Part-time), Shepherd School of Music

Rice University · Houston, TX, US · Posted 2026-08-27

### Summary The House Manager plays a pivotal role in creating and delivering an exceptional on-site experience for patrons of the Shepherd School of Music. This position manages front-of-house operations for a robust calendar of orchestral, chamber, and opera performances, and is responsible for recruiting, scheduling

HousePart-timeShepherdSchoolMusicmanagersummaryplays

Program Administrator II

Rice University · Houston, TX, US · Posted 2026-08-26

### Summary The Program Administrator plays a central role in the day-to-day operations of the Department of Mechanical Engineering, supporting programs, faculty, staff, and students across course scheduling, undergraduate student employment, budget administration, events, outreach, and communications. This is an oppor

ProgramAdministratordepartmentfacultystaffopportunityricesummary

Research Technician I

Rice University · Houston, TX, US · Posted 2026-08-24

### Summary The Stadler Lab is seeking a motivated, organized, and detail-oriented Research Technician I with wet-lab and molecular biology experience to support a Houston-wide wastewater surveillance project in partnership with the Houston Health Department and Houston Water. A major focus of the Stadler Lab is using

ResearchTechnicianwastewaterstadlermolecularsupportprojecthouston

Housekeeper, Wiess President’s House

Rice University · Houston, TX, US · Posted 2026-08-21

### Summary The Housekeeper is responsible for maintaining the cleanliness, organization, and overall presentation of the Rice University President’s official residence. This role ensures the home reflects the highest standards of care, supporting both the private living environment of the President and his family, and

HousekeeperWiessPresidentHousesummaryresponsiblemaintainingcleanliness

Assistant Director, Annual Giving

Rice University · US · Posted 2026-08-21

### Summary Reporting to the Associate Athletic Director of Revenue Generation, the Assistant Director of Annual Giving will assist in carrying out designated duties and responsibilities for the Rice Athletics Owl Club annual giving program. This individual will be involved with the planning, coordination, implementati

AssistantDirectorAnnualGivingriceclubsummaryreporting

Maintenance Technician I

Rice University · Houston, TX, US · Posted 2026-08-21

### Summary The Maintenance Technician I performs skilled work with limited oversight, including the installation, troubleshooting, repair, and preventive maintenance of facility buildings, systems, and equipment, such as electrical, HVAC, plumbing, and structural systems.

MaintenanceTechniciansummaryperformsskilledlimitedoversightinstallation

Postdoctoral Associate - Earth Environmental Planetary Sciences

Rice University · Houston, TX, US · Posted 2026-08-20

### Summary Dr. Ian McBrearty’s lab in the Department of Earth, Environmental and Planetary Sciences is looking to hire a Postdoctoral Research Associate in the field of Machine Learning & Geophysics. The ideal candidate will hold a Ph.D. in a quantitative field with strong Python and deep learning skills to build data

Python

Temporary Creative Designer

Rice University · Houston, TX, US · Posted 2026-08-19

### Summary The Office of Public Affairs at Rice University is seeking an agile and highly creative, Temporary Creative Designer to support our Creative Services team. This position requires a "full-lifecycle" creative thinker—someone who can brainstorm a fresh concept on the fly, pitch it to a client, and manage it al

CreativeDesignersummaryofficepublicaffairsriceuniversity

Development Specialist II

Rice University · Houston, TX, US · Posted 2026-08-19

### Summary The Development Specialist serves a vital, interactive role within the office of the dean and is responsible for facilitating the natural sciences development and communications teams in achieving individual and group goals and coordinating the natural sciences donor and alumni efforts.

DevelopmentSpecialistnaturalsciencessummaryservesvitalinteractive

Temporary Veterinary Technician II

Rice University · Houston, TX, US · Posted 2026-08-19

### Summary The Temporary Veterinary Technician II will assist members of the veterinary staff, research staff, and animal care staff in providing exceptional care for laboratory animals in Rice University’s growing animal care and use program. The veterinary technician will aid in all aspects of the animal care progra

VeterinaryTechniciancareanimalstaffmembersprogramsummary

Head of Venture Acceleration, Program Manager

Rice University · US · Posted 2026-08-19

### Summary The Liu Idea Lab for Innovation & Entrepreneurship (Lilie) is seeking a Program Manager to lead our Venture Acceleration program.

HeadVentureAccelerationProgramsummaryideainnovationentrepreneurship

Police Officer

Rice University · Houston, TX, US · Posted 2026-08-17

### Summary With minimal supervision from a police sergeant, a police officer with the Rice University Police Department is responsible for the protection of life and property on the campus and any properties under the care, custody, and control of the university.

PoliceOfficersummaryminimalsupervisionfromsergeantrice

Temporary Web Content Specialist

Rice University · Houston, TX, US · Posted 2026-08-17

### Summary The Office of Public Affairs is seeking a part-time Web Content Specialist to support ongoing website content maintenance and light front-end development within a Drupal CMS environment. This role is ideal for someone with a solid foundation in HTML, CSS, and JavaScript who is comfortable managing web conte

JavaScriptHTMLCSS

Equipment Manager, Football

Rice University · US · Posted 2026-08-17

### Summary The Football Equipment Manager is responsible for assisting the Assistant A.D. for Equipment Operations with outfitting the team on an annual basis in accordance with team needs, safety requirements, and NCAA and conference regulations. This person will primarily be responsible for hiring, training, schedul

EquipmentFootballresponsibleneedsworkerssummarymanagerassisting

Lab Manager

Rice University · Houston, TX, US · Posted 2026-08-14

### Summary The Research Scientist/Lab Manager performs biomaterial fabrication and characterization within the Biomaterials Lab (https://bml.rice.edu) under the supervision of the Director. These fabrication methods include, but are not limited to, 3D printing, bioprinting, electrospinning, melt-write electrospinning,

Labresearchlaboratorybiomaterialfabricationcharacterizationbiomaterialsinclude

Maintenance Technician II

Rice University · Houston, TX, US · Posted 2026-08-13

### Summary The Maintenance Technician II (Day, Night, or Weekend Shift) plays a key role in keeping our facilities safe, efficient, and fully operational. Working with limited oversight, this role involves installing, troubleshooting, repairing, and performing preventative maintenance on a variety of systems, includin

MaintenanceTechniciansummarynightweekendshiftplayskeeping

Digital Content Specialist

Rice University · Houston, TX, US · Posted 2026-08-12

### Summary The Digital Content Specialist serves as a key contributor to Rice's Development and Alumni Relations division, responsible for developing, managing, and optimizing digital content across email and web channels. Central to this role is dedicated ownership of high-volume, technically complex Annual Giving em

DigitalContentSpecialistemailsummaryservescontributorrice

Assistant General Counsel

Rice University · Houston, TX, US · Posted 2026-08-11

### Summary In the Office of General Counsel, we serve a preeminent research university whose excellence is established and whose ambitions, under President Reginald DesRoches, are courageous, transformational, and global. To help us serve Rice’s bright future, we are expanding the office to add an Assistant General Co

AssistantGeneralCounselofficeservewhosericesummary

Associate Director of Graduate Recruitment, Rice Global India

Rice University · Houston, TX, US · Posted 2026-08-10

### Summary The Associate Director of Graduate Recruitment, Rice Global India, serves a critical role in advancing Rice University's graduate enrollment strategy across India by implementing and expanding recruitment efforts for Rice's industry-aligned Professional Master's programs.

DirectorGraduateRecruitmentRiceGlobalIndiasummaryassociate

Assistant Vice President of Campus Planning and Design, University Architect

Rice University · Houston, TX, US · Posted 2026-08-05

### Summary The Assistant Vice President of Planning & Design and University Architect (AVP) serves as Rice University’s primary steward of campus buildings, landscapes, public spaces, and the built environment. Reporting to the Associate Vice President of Facilities, Planning & Capital Construction, the AVP leads the

AssistantVicePresidentCampusPlanningDesignuniversityserves

Postdoctoral Associate - Bioengineering

Rice University · Houston, TX, US · Posted 2026-08-03

### Summary The Biophotonics Instrumentation Laboratory in the Department of Bioengineering at Rice University seeks a Postdoctoral Research Associate to support the development of advanced optical instrumentation for imaging and sensing applications. This position will focus on the design, fabrication, integration, an

PostdoctoralBioengineeringinstrumentationresearchimagingsensingsummarybiophotonics

Postdoctoral Associate - BioSciences

Rice University · Houston, TX, US · Posted 2026-07-30

### Summary Dr. Caroline Ajo-Franklin’s lab in the Department of BioSciences is looking to hire a Postdoctoral Research Associate in protein self-assembly at interfaces. We are seeking a highly motivated postdoctoral research associate to join the S-LATTICE project.

PostdoctoralBioSciencesresearchassociatesummarycarolineajo-franklindepartment

Program Administrator II

Rice University · Houston, TX, US · Posted 2026-07-30

### Summary The Program Administrator II supports the administration of departmental programs, events, and related activities within the Department of Chemical and Biomolecular Engineering (ChBE) in Rice’s George R. Brown School of Engineering and Computing. This role coordinates daily operations across multiple progra

ProgramAdministratoractivitiesdepartmentaleventsengineeringplanningcommunications

Assistant Director, Creative Services

Rice University · US · Posted 2026-07-29

### Summary The Assistant Director, Creative Services will produce high-impact video, photo, and digital content designed to enhance recruiting, fan engagement, brand growth, and the student-athlete experience across multiple platforms. Working collaboratively within the Creative Services team and alongside coaches, ad

AssistantDirectorCreativeServicescontentsummaryproducehigh-impact

Assistant Director of Marketing

Rice University · US · Posted 2026-07-26

### Summary The Assistant Director of Marketing will play an integral role in driving revenue and attendance for the Department of Athletics. Along with the marketing, sales, and communications staff, this individual will assist in increasing attendance, creating a positive and exciting game day atmosphere, increasing

AssistantDirectorMarketingattendanceathleticsincreasingsummaryplay

SEA Cryogenic Electron Microscopist

Rice University · Houston, TX, US · Posted 2026-07-20

### Summary The SEA Cryogenic Electron Microscopist is responsible for the management, maintenance, and operation of specialized scientific research equipment (ThermoFisher Glacios) in the cryo-EM core lab facilities for the Office of Research, through the Shared Equipment Authority (SEA). As part of the biological ins

SEACryogenicElectronMicroscopistresearchequipmentfacilitiesother

Barista

Rice University · Houston, TX, US · Posted 2026-07-14

### Summary The Barista is an entry-level position responsible for preparing beverages and providing excellent guest service in a fast-paced café environment. This role supports daily operations by maintaining cleanliness, efficiency, and consistency while creating a welcoming and positive experience for all guests.

Baristasummaryentry-levelresponsiblepreparingbeveragesprovidingexcellent

Lead Barista

Rice University · Houston, TX, US · Posted 2026-07-14

### Summary The Lead Barista is responsible for overseeing daily coffee shop operations within Rice Retail Dining while delivering an elevated hospitality experience aligned with Rice Hospitality standards. This role leads by example in beverage execution, guest engagement, and team development, ensuring consistency in

Baristaricehospitalitysummaryleadresponsibleoverseeingdaily

Postdoctoral Associate - Chemistry

Rice University · Houston, TX, US · Posted 2026-07-13

### Summary Prof. Yruegas’ research group in the Department of Chemistry at Rice University is seeking a Postdoctoral Research Associate in the field of synthetic inorganic chemistry. The successful candidate will perform synthetic inorganic chemistry research toward designing new catalytic chemical reactions and provi

PostdoctoralChemistryresearchsyntheticinorganictowardsummaryprof

Research Scientist

Rice University · Houston, TX, US · Posted 2026-07-09

### Summary The department of Chemical and Biomolecular Engineering is searching for a Research Scientist in the Research Group of Prof. Sibani Biswal. The research scientist will conduct independent experimental studies and manage research projects and related budgets. This position communicates the results of scienti

ResearchScientistsummarydepartmentchemicalbiomolecularengineeringsearching

Dishwasher

Rice University · Houston, TX, US · Posted 2026-07-01

### Summary The Dishwasher/Steward is responsible for maintaining cleanliness, sanitation, and operational efficiency in Rice University dining facilities. This role ensures that all kitchenware, service equipment, and work areas comply with university standards, health department regulations, and food safety guideline

Dishwashersanitationuniversitysummarystewardresponsiblemaintainingcleanliness

Cohen House Steward

Rice University · Houston, TX, US · Posted 2026-07-01

### Summary The Cohen House Steward provides routine and event-driven housekeeping and stewarding support for Rice University’s Faculty Club. Duties include daily cleaning of offices, restrooms, kitchens, dining rooms, and public areas; dishwashing support; trash and linen removal; floor care; and maintaining sanitatio

CohenHouseStewardsupportroomssummaryprovidesroutine

Hospitality Assistant

Rice University · Houston, TX, US · Posted 2026-06-17

### Summary The Hospitality Assistant is responsible for preparing a variety of dishes in accordance with established menus and standardized recipes. This role ensures that high standards of food quality, sanitation, and presentation are consistently maintained, while also upholding cleanliness in the work area and sup

HospitalityAssistantsanitationsummaryresponsiblepreparingvarietydishes

Assistant Athletic Trainer

Rice University · US · Posted 2026-06-15

### Summary The assistant athletic trainer will develop and maintain a high degree of total health care for student athletes. This person will be responsible for the prevention and care and treatment of athletic injuries and the supervision of equipment and physical therapy modalities. The successful candidate will hav

AssistantAthleticTrainercaresummarydevelopmaintainhigh

Culinary Assistant

Rice University · Houston, TX, US · Posted 2026-06-09

### Summary The Dining Assistant is responsible for preparing a variety of dishes in accordance with established menus and standardized recipes. This role ensures high standards of food quality, sanitation, and presentation are consistently maintained, while also upholding cleanliness in the work area and supporting ov

CulinaryAssistantsanitationsummarydiningresponsiblepreparingvariety

Plumbing Supervisor

Rice University · Houston, TX, US · Posted 2026-06-05

### Summary The Plumbing Supervisor is responsible for supervising the plumbing staff in the Facilities and Capital Planning Department to ensure proper operation and maintenance of plumbing systems, building piping, and lab air distribution systems (within the buildings), including on-campus water, gas, sewer, steam,

PlumbingSupervisorsystemsemployeessummaryresponsiblesupervisingstaff

Bus Driver

Rice University · Houston, TX, US · Posted 2026-06-05

### Summary The Bus Driver is responsible for the safe operation of Rice University buses and for providing excellent transportation and customer service to the Rice community and visitors.

BusDriverricesummaryresponsiblesafeoperationuniversity

Senior Director, Prospect Management

Rice University · Houston, TX, US · Posted 2026-06-03

### Summary The Senior Director, Prospect Management leads portfolio strategy and prospect management efforts that strengthen fundraising effectiveness and pipeline growth. Partnering closely with development leadership, this role enhances portfolio quality, drives prospect movement, and supports campaign readiness. Th

DirectorProspectManagementportfoliosummaryseniorleadsstrategy

Residential Dining Manager

Rice University · Houston, TX, US · Posted 2026-05-12

### Summary The Residential Dining Manager provides management oversight of a residential dining operation to ensure high-quality performance across all activities. This position manages, directs, plans, organizes, and supervises dining staff in collaboration with the executive chef of the assigned servery while meetin

ResidentialDiningmanagerhigh-qualitysummaryprovidesmanagementoversight

Retail Dining Manager

Rice University · Houston, TX, US · Posted 2026-05-11

### Summary The Retail Dining Manager for Rice Hospitality provides front-of-house leadership and operational oversight across multiple retail and hospitality outlets, including coffee shops, and campus dining concepts. This role is responsible for ensuring consistent service standards, operational efficiency, and exce

RetailDininghospitalityoperationalsummarymanagerriceprovides

Front of House Coordinator

Rice University · Houston, TX, US · Posted 2026-05-08

### Summary The Front of House Coordinator (FOH Coordinator) ensures the efficient and effective operation of the assigned servery. Under the direction of the Dining Manager, this role serves as the primary supervisor for front-of-house dining assistants and operations. Key responsibilities include greeting guests, sca

FrontHouseCoordinatordiningservesassistantssummaryensures

Term-Limited Hospitality Assistant

Rice University · Houston, TX, US · Posted 2026-05-07

### Summary The Term-Limited Hospitality Assistant serves as the primary point of contact for guests and is directly responsible for delivering a high-quality experience. This role is responsible for greeting customers, scanning student ID cards, and verifying meal plans. Under the direction of the Hospitality Manager,

Term-LimitedHospitalityAssistantresponsiblesummaryservesprimarypoint

Banquet Server

Rice University · Houston, TX, US · Posted 2026-05-07

### Summary The banquet server is responsible for providing set up for events at the Faculty Club while providing outstanding service to all clients during both luncheon service and private events. This person assists on luncheons for the University, the President of the University, the Board of Trustees, Rice Women’s

BanquetServerclubserviceprovidinguniversityensuredining

Banquet Captain

Rice University · Houston, TX, US · Posted 2026-05-07

### Summary The Banquet Captain plays a key leadership role across Rice Hospitality’s event operations, supporting Cohen House, and campus-wide catering services. This position is responsible for executing high-quality events, ensuring exceptional service standards, and acting as a primary point of contact for clients

BanquetCaptainsummaryplaysleadershipricehospitalityevent

Postdoctoral Associate - Bioengineering

Rice University · Houston, TX, US · Posted 2026-04-28

### Summary The laboratory of Dr. Caleb J. Bashor in the Department of Bioengineering at Rice University seeks to hire a motivated Postdoctoral Research Associate to conduct high-impact research in mammalian synthetic biology and cell-based therapeutic engineering. The successful candidate will contribute to a fast-pac

PostdoctoralBioengineeringresearchmammalianbiologytherapeuticsummarylaboratory

Lead Cook

Rice University · Houston, TX, US · Posted 2026-04-28

### Summary The Lead Cook prepares a variety of foods in accordance with menu instructions and standardized recipes. This position ensures that proper food standards are maintained in the areas of quality, sanitation, and appearance, maintains a clean work area, and assists with general kitchen cleaning. The Lead Cook

Cookkitchenleadfoodareasassistsstationsprep

Cook

Rice University · Houston, TX, US · Posted 2026-04-28

### Summary The Cook prepares a variety of foods in accordance with menu instructions and standardized recipes. This role ensures that proper food standards are maintained in the areas of quality, sanitation, and appearance. The Cook maintains a clean work area and assists with general kitchen cleaning. In addition to

Cooksummarypreparesvarietyfoodsaccordancemenuinstructions

Director of Development – Gift Planning

Rice University · Houston, TX, US · Posted 2026-03-10

### Summary Reporting to the Executive Director of Gift Planning, the Director of Development – Gift Planning is responsible for securing planned gifts and/or blended gifts; i.e., a combination of annual, outright, revocable and irrevocable life income gifts. Primary responsibilities include the identification, cultiva

DirectorDevelopmentGiftPlanninggiftssecuringplannedother

Research Technician III (McHugh)

Rice University · Houston, TX, US · Posted 2026-02-26

### Summary The McHugh Lab in the Department of Bioengineering at Rice University seeks to hire a Research Technician II to support research focused on the development of translational vaccine and drug delivery platforms. The lab’s work integrates biomaterials design, advanced manufacturing techniques, and immunoengine

ResearchTechnicianIIIMcHughdeliverysummarydepartmentbioengineering

Postdoctoral Associate - Bioengineering

Rice University · Houston, TX, US · Posted 2026-02-19

### Summary The McHugh Lab in the Departments of Bioengineering and Chemistry at Rice University (Houston, TX) seeks to hire a postdoctoral associate working in the area of chemistry to develop novel materials for controlled vaccine delivery. At a high level, the McHugh Lab is focused on the development of translationa

PostdoctoralBioengineeringmchughchemistrydeliverysummarydepartmentsrice

Postdoctoral Associate - Bioengineering

Rice University · Houston, TX, US · Posted 2026-02-19

### Summary The McHugh Lab in the Department of Bioengineering at Rice University (Houston, TX) seeks to hire a postdoctoral associate working in the area of immunology for novel vaccine development. At a high level, the McHugh Lab is focused on the development of translational drug delivery platforms with the potentia

PostdoctoralBioengineeringmchughdeliverysummarydepartmentriceuniversity

Postdoctoral Associate - Bioengineering

Rice University · Houston, TX, US · Posted 2025-08-19

### Summary The Veiseh Lab in the Department of Bioengineering at Rice University is seeking a highly motivated and collaborative Postdoctoral Researcher to lead the development of cell-based therapeutic devices for the treatment of diseases such as cancer, lymphedema, wound infections, diabetes, or infectious diseases

PostdoctoralBioengineeringsummaryveisehdepartmentriceuniversityseeking